Non Neuronal Enolase (ENO1) Rabbit Polyclonal Antibody TA335866 from OriGene Technologies | Biocompare.com

Supplier Images

Non Neuronal Enolase (ENO1) Rabbit Polyclonal Antibody

Be the first to write a review!

Supplier Page from
OriGene Technologies for
Non Neuronal Enolase (ENO1) Rabbit Polyclonal Antibody

OriGene Technologies' Non Neuronal Enolase (ENO1) Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Immunohistochemistry, and Western Blot. The Non Neuronal Enolase (ENO1) Rabbit Polyclonal Antibody was generated using ENO1, and enolase 1 as the antigen and it reacts with Human, and Rat.

Description

Rabbit Polyclonal Anti-ENO1 Antibody

Product Specs
ItemNon Neuronal Enolase (ENO1) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price Pricing Info Supplier Page View Company Product Page
Catalog NumberTA335866
Quantity100 µl
ApplicationsIHC, WB
Conjugate/TagUnconjugated
PurityProtein A purified
ReactivityHuman, Rat
TargetENO1
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for Anti-ENO1 Antibody: synthetic peptide directed towards the C terminal of human ENO1. Synthetic peptide located within the following region: VVGLCTGQIKTGAPCRSERLAKYNQLLRIEEELGSKAKFAGRNFRNPLAK
NCBI Full Gene Nameenolase 1
NCBI Gene AliasesMPB1, NNE, PPH, HEL-S-17, ENO1L1
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!